PDB entry 1v9i

View 1v9i on RCSB PDB site
Description: Crystal Structure Analysis of the site specific mutant (Q253C) of bovine carbonic anhydrase II
Class: lyase
Keywords: beta sheet, zinc metalloenzyme
Deposited on 2004-01-26, released 2004-02-10
The last revision prior to the SCOP 1.73 freeze date was dated 2004-02-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.247
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: carbonic anhydrase II
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00921 (2-260)
      • cloning artifact (0-1)
      • engineered (254)
    Domains in SCOP 1.73: d1v9ic_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1v9iC (C:)
rcshhwgygkhngpehwhkdfpiangerqspvdidtkavvqdpalkplalvygeatsrrm
vnnghsfnveyddsqdkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelh
lvhwntkygdfgtaaqqpdglavvgvflkvgdanpalqkvldaldsiktkgkstdfpnfd
pgsllpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepell
mlanwrpaqplknrcvrgfpk