PDB entry 1v9h

View 1v9h on RCSB PDB site
Description: Crystal structure of the RNase MC1 mutant Y101A in complex with 5'-UMP
Class: hydrolase
Keywords: Hydolase, Nucleic acid, RNA, HYDROLASE
Deposited on 2004-01-26, released 2004-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease MC
    Species: Momordica charantia [TaxId:3673]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23540 (7-196)
      • cloning artifact (4-6)
      • see remark 999 (46)
      • engineered (107)
      • see remark 999 (170)
    Domains in SCOPe 2.08: d1v9ha1, d1v9ha2
  • Heterogens: SO4, U5P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v9hA (A:)
    eaeayvefdsfwfvqqwppavcsfqksgscpgsglrtftihglwpqqsgtsltncpgspf
    ditkishlqsqlntlwpnvlrannqqfwshewtkhgtcsestfnqaaafklavdmrnnyd
    iigalrphaagpngrtksrqaikgflkakfgkfpglrcrtdpqtkvsylvevvacfaqdg
    stlidctrdtcganfif
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9hA (A:)
    yvefdsfwfvqqwppavcsfqksgscpgsglrtftihglwpqqsgtsltncpgspfditk
    ishlqsqlntlwpnvlrannqqfwshewtkhgtcsestfnqaaafklavdmrnnydiiga
    lrphaagpngrtksrqaikgflkakfgkfpglrcrtdpqtkvsylvevvacfaqdgstli
    dctrdtcganfif