PDB entry 1v9e

View 1v9e on RCSB PDB site
Description: Crystal Structure Analysis of Bovine Carbonic Anhydrase II
Class: lyase
Keywords: high-resolution, twisted beta sheet, zinc metalloenzyme, lyase
Deposited on 2004-01-26, released 2004-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.27
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase II
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v9ea_
  • Chain 'B':
    Compound: carbonic anhydrase II
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v9eb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v9eA (A:)
    shhwgygkhngpehwhkdfpiangerqspvdidtkavvqdpalkplalvygeatsrrmvn
    nghsfnveyddsqdkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelhlv
    hwntkygdfgtaaqqpdglavvgvflkvgdanpalqkvldaldsiktkgkstdfpnfdpg
    sllpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepellml
    anwrpaqplknrqvrgfpk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v9eB (B:)
    shhwgygkhngpehwhkdfpiangerqspvdidtkavvqdpalkplalvygeatsrrmvn
    nghsfnveyddsqdkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelhlv
    hwntkygdfgtaaqqpdglavvgvflkvgdanpalqkvldaldsiktkgkstdfpnfdpg
    sllpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepellml
    anwrpaqplknrqvrgfpk