PDB entry 1v9d

View 1v9d on RCSB PDB site
Description: Crystal structure of the core FH2 domain of mouse mDia1
Class: protein binding
Keywords: helix bundle, PROTEIN BINDING
Deposited on 2004-01-24, released 2004-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.236
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diaphanous protein homolog 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v9da_
  • Chain 'B':
    Compound: Diaphanous protein homolog 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v9db_
  • Chain 'C':
    Compound: Diaphanous protein homolog 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v9dc_
  • Chain 'D':
    Compound: Diaphanous protein homolog 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v9dd_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v9dA (A:)
    gskkkvkelkvldsktaqnlsiflgsfrmpyqeiknvilevneavltesmiqnlikqmpe
    peqlkmlselkeeyddlaeseqfgvvmgtvprlrprlnailfklqfseqvenikpeivsv
    taaceelrksenfsslleltllvgnymnagsrnagafgfnisflcklrdtksadqkmtll
    hflaelcendhpevlkfpdelahvekasrvsaenlqksldqmkkqiadverdvqnfpaat
    dekdkfvekmtsfvkdaqeqynklrmmhsnmetlykelgdyfvfdpkklsveeffmdlhn
    frnmflqavkenqkrreteekmrraklakekaekerlekq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9dA (A:)
    vkelkvldsktaqnlsiflgsfrmpyqeiknvilevneavltesmiqnlikqmpepeqlk
    mlselkeeyddlaeseqfgvvmgtvprlrprlnailfklqfseqvenikpeivsvtaace
    elrksenfssllsflcklrdtksadqkmtllhflaelcendhpevlkfpdelahvekasr
    vsaenlqksldqmkkqiadverdvqnfpaatdekdkfvekmtsfvkdaqeqynklrmmhs
    nmetlykelgdyfvfdpkklsveeffmdlhnfrnmflqavkenqkrreteekmrraklak
    ekaekerl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v9dB (B:)
    gskkkvkelkvldsktaqnlsiflgsfrmpyqeiknvilevneavltesmiqnlikqmpe
    peqlkmlselkeeyddlaeseqfgvvmgtvprlrprlnailfklqfseqvenikpeivsv
    taaceelrksenfsslleltllvgnymnagsrnagafgfnisflcklrdtksadqkmtll
    hflaelcendhpevlkfpdelahvekasrvsaenlqksldqmkkqiadverdvqnfpaat
    dekdkfvekmtsfvkdaqeqynklrmmhsnmetlykelgdyfvfdpkklsveeffmdlhn
    frnmflqavkenqkrreteekmrraklakekaekerlekq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9dB (B:)
    kelkvldsktaqnlsiflgsfrmpyqeiknvilevneavltesmiqnlikqmpepeqlkm
    lselkeeyddlaeseqfgvvmgtvprlrprlnailfklqfseqvenikpeivsvtaacee
    lrksenfsslleltllvgnymnagsrnagafgfnisflcklrdtksadqkmtllhflael
    cendhpevlkfpdelahvekasrvsaenlqksldqmkkqiadverdvqnfpaatdekdkf
    vekmtsfvkdaqeqynklrmmhsnmetlykelgdyfvfdpkklsveeffmdlhnfrnmfl
    qavkenqkrreteekmrrakl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v9dC (C:)
    gskkkvkelkvldsktaqnlsiflgsfrmpyqeiknvilevneavltesmiqnlikqmpe
    peqlkmlselkeeyddlaeseqfgvvmgtvprlrprlnailfklqfseqvenikpeivsv
    taaceelrksenfsslleltllvgnymnagsrnagafgfnisflcklrdtksadqkmtll
    hflaelcendhpevlkfpdelahvekasrvsaenlqksldqmkkqiadverdvqnfpaat
    dekdkfvekmtsfvkdaqeqynklrmmhsnmetlykelgdyfvfdpkklsveeffmdlhn
    frnmflqavkenqkrreteekmrraklakekaekerlekq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9dC (C:)
    vkelkvldsktaqnlsiflgsfrmpyqeiknvilevneavltesmiqnlikqmpepeqlk
    mlselkeeyddlaeseqfgvvmgtvprlrprlnailfklqfseqvenikpeivsvtaace
    elrknfssllelmtllhflaelcendhpevllahvekasrvsaenlqksldqmkkqiadv
    erdvqnfpaatdekdkfvekmtsfvkdaqeqynklrmmhsnmetlykelgdyfvfdpkkl
    sveeffmdlhnfrnmflqavkenqkrreteekmrrakl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1v9dD (D:)
    gskkkvkelkvldsktaqnlsiflgsfrmpyqeiknvilevneavltesmiqnlikqmpe
    peqlkmlselkeeyddlaeseqfgvvmgtvprlrprlnailfklqfseqvenikpeivsv
    taaceelrksenfsslleltllvgnymnagsrnagafgfnisflcklrdtksadqkmtll
    hflaelcendhpevlkfpdelahvekasrvsaenlqksldqmkkqiadverdvqnfpaat
    dekdkfvekmtsfvkdaqeqynklrmmhsnmetlykelgdyfvfdpkklsveeffmdlhn
    frnmflqavkenqkrreteekmrraklakekaekerlekq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9dD (D:)
    kelkvldsktaqnlsiflgsfrmpyqeiknvilevneavltesmiqnlikqmpepeqlkm
    lselkeeyddlaeseqfgvvmgtvprlrprlnailfklqfseqvenikpeivsvtaacee
    lrksenfsslleltsflcklrdtksadqkmtllhflaelcendhpevlkfpdelahveka
    srvsaenlqksldqmkkqiadverdvqnfpaatdekdkfvekmtsfvkdaqeqynklrmm
    hsnmetlykelgdyfvfdpkklsveeffmdlhnfrnmflqavkenqkrreteekmrrakl