PDB entry 1v9c

View 1v9c on RCSB PDB site
Description: Crystal Analysis of Precorrin-8x Methyl Mutase from Thermus Thermophilus
Class: isomerase
Keywords: ALPHA-BETA WIND, DOUBLY WOUND SHEET, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, ISOMERASE
Deposited on 2004-01-23, released 2004-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.221
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Precorrin-8x Methyl Mutase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v9ca_
  • Chain 'B':
    Compound: Precorrin-8x Methyl Mutase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v9cb_
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v9cA (A:)
    mtekgraieeesfrivdqeagphgfsplewpvvrrmihatadfeykaltrfsqgaveagl
    kaiqagarilvdarmiacglnperlrlfgnevvellahpevvarakatggtraeaavaya
    wekglldgaivgvgnaptfllalveairqgarpalvlgmpvgfvnvleakralmeapvpw
    ivtegrkggstlvvaalhalirlaadggvdtsrayreg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9cA (A:)
    raieeesfrivdqeagphgfsplewpvvrrmihatadfeykaltrfsqgaveaglkaiqa
    garilvdarmiacglnperlrlfgnevvellahpevvartraeaavayawekglldgaiv
    gvgnaptfllalveairqgarpalvlgmpvgfvnvleakralmeapvpwivtegrkggst
    lvvaalhalirlaadggv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v9cB (B:)
    mtekgraieeesfrivdqeagphgfsplewpvvrrmihatadfeykaltrfsqgaveagl
    kaiqagarilvdarmiacglnperlrlfgnevvellahpevvarakatggtraeaavaya
    wekglldgaivgvgnaptfllalveairqgarpalvlgmpvgfvnvleakralmeapvpw
    ivtegrkggstlvvaalhalirlaadggvdtsrayreg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9cB (B:)
    graieeesfrivdqeagphgfsplewpvvrrmihatadfeykaltrfsqgaveaglkaiq
    agarilvdarmiacglnperlrlfgnevvellahpevvarakattraeaavayawekgll
    dgaivgvgnaptfllalveairqgarpalvlgmpvgfvnvleakralmeapvpwivtegr
    kggstlvvaalhalirlaadggvdts