PDB entry 1v9a

View 1v9a on RCSB PDB site
Description: Crystal structure of Uroporphyrin-III C-methyl transferase from Thermus thermophilus complexed with S-adenyl homocysteine
Class: transferase
Keywords: transferase, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-01-23, released 2005-02-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.215
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uroporphyrin-III C-methyltransferase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1v9aa1
  • Chain 'B':
    Compound: Uroporphyrin-III C-methyltransferase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1v9ab_
  • Heterogens: FLC, SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v9aA (A:)
    grvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyvgkeegesek
    qeeihrlllrharahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasgl
    plthrglahgfaavsgvlegggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpre
    ptlfverastpkerrvharleevaegkvevrppalwilgevvrvfaekeapvdalalgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9aA (A:)
    grvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyvgkkqeeihr
    lllrharahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasglplthrg
    lahgfaavsgvlegggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpreptlfve
    rastpkerrvharleevaegkvevrppalwilgevvrvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v9aB (B:)
    grvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyvgkeegesek
    qeeihrlllrharahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasgl
    plthrglahgfaavsgvlegggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpre
    ptlfverastpkerrvharleevaegkvevrppalwilgevvrvfaekeapvdalalgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9aB (B:)
    grvylvgagpgdpelltlkayrllkeapvvlydrlvdervlalapgekvyvgkeihrlll
    rharahpfvvrlkggdpmvfgrggeevlfllrhgvpvevvpgvtsllasglplthrglah
    gfaavsgvlegggypdlrpfarvptlvvlmgvgrrvwiakellrlgrdpreptlfveras
    tpkerrvharleevaegkvevrppalwilgevvrvfaekeapvdalal