PDB entry 1v98

View 1v98 on RCSB PDB site
Description: Crystal Structure Analysis of Thioredoxin from Thermus thermophilus
Class: oxidoreductase
Keywords: oxidoreductase, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-01-21, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.195
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v98a_
  • Chain 'B':
    Compound: thioredoxin
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v98b_
  • Heterogens: MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v98A (A:)
    mvvtcpkcgaknrlgtpppgqvpvcgacktplpwvveadekgfaqevagapltlvdffap
    wcgpcrlvspileelardhagrlkvvkvnvdehpglaarygvrsvptlvlfrrgapvatw
    vgasprrvleerlrpylegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v98A (A:)
    gapltlvdffapwcgpcrlvspileelardhagrlkvvkvnvdehpglaarygvrsvptl
    vlfrrgapvatwvgasprrvleerlrpylegr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v98B (B:)
    mvvtcpkcgaknrlgtpppgqvpvcgacktplpwvveadekgfaqevagapltlvdffap
    wcgpcrlvspileelardhagrlkvvkvnvdehpglaarygvrsvptlvlfrrgapvatw
    vgasprrvleerlrpylegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v98B (B:)
    pltlvdffapwcgpcrlvspileelardhagrlkvvkvnvdehpglaarygvrsvptlvl
    frrgapvatwvgasprrvleerlrpyleg