PDB entry 1v96

View 1v96 on RCSB PDB site
Description: Crystal structure of hypothetical protein of unknown function from pyrococcus horikoshii OT3
Class: structural genomics, unknown function
Keywords: Rossmann fold, tRNA synthetase, nucleotide binding protein, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-01-21, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.209
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PH0500
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v96a1
  • Chain 'B':
    Compound: hypothetical protein PH0500
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v96b_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v96A (A:)
    mplppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltaraylkknieaef
    eilkdiynivpllddiaikaaqieanlikkeitldmediitattaiytnsllvtddpkry
    epirrfgldtmpldkfikevelmvekeli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v96A (A:)
    plppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltarlkknieaefeil
    kdiynivpllddiaikaaqieanlikkeitldmediitattaiytnsllvtddpkryepi
    rrfgldtmpldkfikevelmvekeli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v96B (B:)
    mplppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltaraylkknieaef
    eilkdiynivpllddiaikaaqieanlikkeitldmediitattaiytnsllvtddpkry
    epirrfgldtmpldkfikevelmvekeli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v96B (B:)
    plppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltaraylkknieaefe
    ilkdiynivpllddiaikaaqieanlikkeitldmediitattaiytnsllvtddpkrye
    pirrfgldtmpldkfikevelmve