PDB entry 1v95

View 1v95 on RCSB PDB site
Description: Solution Structure of Anticodon Binding Domain from Nuclear Receptor Coactivator 5 (Human KIAA1637 Protein)
Class: RNA binding protein
Keywords: Nuclear receptor coactivator 5, Coactivator independent of AF-2 function (CIA), Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2004-01-20, released 2004-07-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor coactivator 5
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA fj00747s1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HCD5 (7-123)
      • cloning artifact (0-6)
      • cloning artifact (124-129)
    Domains in SCOPe 2.06: d1v95a1, d1v95a2, d1v95a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v95A (A:)
    gssgssgpvdcsvivvnkqtkdyaesvgrkvrdlgmvvdliflntevslsqaledvsrgg
    spfaivitqqhqihrsctvnimfgtpqehrnmpqadamvlvarnyeryknecrekereei
    arqasgpssg