PDB entry 1v95

View 1v95 on RCSB PDB site
Description: solution structure of anticodon binding domain from nuclear receptor coactivator 5 (human kiaa1637 protein)
Deposited on 2004-01-20, released 2004-07-20
The last revision prior to the SCOP 1.71 freeze date was dated 2004-07-20, with a file datestamp of 2004-07-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1v95a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v95A (A:)
    gssgssgpvdcsvivvnkqtkdyaesvgrkvrdlgmvvdliflntevslsqaledvsrgg
    spfaivitqqhqihrsctvnimfgtpqehrnmpqadamvlvarnyeryknecrekereei
    arqasgpssg