PDB entry 1v94

View 1v94 on RCSB PDB site
Description: Crystal structure of isocitrate dehydrogenase from Aeropyrum pernix
Class: oxidoreductase
Keywords: isocitrate dehydrogenase, 3 layers, alpha/beta/alpha, OXIDOREDUCTASE
Deposited on 2004-01-20, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.215
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isocitrate dehydrogenase
    Species: Aeropyrum pernix [TaxId:56636]
    Gene: APE0689
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v94a_
  • Chain 'B':
    Compound: isocitrate dehydrogenase
    Species: Aeropyrum pernix [TaxId:56636]
    Gene: APE0689
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v94b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v94A (A:)
    mqvmasppctteelspppggslveysggslrvpdnpvvafirgdgvgpevvesalkvvda
    avkkvyggsrrivwwellaghlarekcgellpkatlegirlarvalkgpletpvgtgyrs
    lnvairqaldlyanirpvryygqpaphkyadrvdmvifrentedvyagiewphdspeaar
    irrflaeefgisiredagigvkpisrfatrrlmeralewalrngntvvtimhkgnimkyt
    egafmrwayevalekfrehvvteqevqekyggvrpegkilvndriadnmlqqiitrpwdy
    qvivapnlngdyisdaasalvggigmaagmnmgdgiavaepvhgtapkyagkdlinpsae
    ilsaslligefmgwrevksiveyairkavqskkvtqdlarhmpgvqplrtseytetliay
    ideadlnevlagkrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v94A (A:)
    ppctteelspppggslveysggslrvpdnpvvafirgdgvgpevvesalkvvdaavkkvy
    ggsrrivwwellaghlarekcgellpkatlegirlarvalkgpletpvgtgyrslnvair
    qaldlyanirpvryygqpaphkyadrvdmvifrentedvyagiewphdspeaarirrfla
    eefgisiredagigvkpisrfatrrlmeralewalrngntvvtimhkgnimkytegafmr
    wayevalekfrehvvteqevqekyggvrpegkilvndriadnmlqqiitrpwdyqvivap
    nlngdyisdaasalvggigmaagmnmgdgiavaepvhgtapkyagkdlinpsaeilsasl
    ligefmgwrevksiveyairkavqskkvtqdlarhmpgvqplrtseytetliayideadl
    nevlagkrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v94B (B:)
    mqvmasppctteelspppggslveysggslrvpdnpvvafirgdgvgpevvesalkvvda
    avkkvyggsrrivwwellaghlarekcgellpkatlegirlarvalkgpletpvgtgyrs
    lnvairqaldlyanirpvryygqpaphkyadrvdmvifrentedvyagiewphdspeaar
    irrflaeefgisiredagigvkpisrfatrrlmeralewalrngntvvtimhkgnimkyt
    egafmrwayevalekfrehvvteqevqekyggvrpegkilvndriadnmlqqiitrpwdy
    qvivapnlngdyisdaasalvggigmaagmnmgdgiavaepvhgtapkyagkdlinpsae
    ilsaslligefmgwrevksiveyairkavqskkvtqdlarhmpgvqplrtseytetliay
    ideadlnevlagkrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v94B (B:)
    ctteelspppggslveysggslrvpdnpvvafirgdgvgpevvesalkvvdaavkkvygg
    srrivwwellaghlarekcgellpkatlegirlarvalkgpletpvgtgyrslnvairqa
    ldlyanirpvryygqpaphkyadrvdmvifrentedvyagiewphdspeaarirrflaee
    fgisiredagigvkpisrfatrrlmeralewalrngntvvtimhkgnimkytegafmrwa
    yevalekfrehvvteqevqekyggvrpegkilvndriadnmlqqiitrpwdyqvivapnl
    ngdyisdaasalvggigmaagmnmgdgiavaepvhgtapkyagkdlinpsaeilsaslli
    gefmgwrevksiveyairkavqskkvtqdlarhmpgvqplrtseytetliayideadlne
    vla