PDB entry 1v93

View 1v93 on RCSB PDB site
Description: 5,10-Methylenetetrahydrofolate Reductase from Thermus thermophilus HB8
Class: oxidoreductase
Keywords: 5,10-methylenetetrahydrofolate reductase, methylenetetrahydrofolate reductase, flavoprotein, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, OXIDOREDUCTASE
Deposited on 2004-01-20, released 2004-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5,10-Methylenetetrahydrofolate reductase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v93a_
  • Heterogens: FAD, DIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v93A (A:)
    mkirdllkarrgplfsfeffppkdpegeealfrtleelkafrpafvsitygamgstrers
    vawaqriqslglnplahltvagqsrkevaevlhrfvesgvenllalrgdpprgervfrph
    pegfryaaelvalirerygdrvsvggaaypeghpesesleadlrhfkakveagldfaitq
    lffnnahyfgflerarragigipilpgimpvtsyrqlrrftevcgasipgpllaklerhq
    ddpkavleigvehavrqvaelleagvegvhfytlnkspatrmvlerlglrpasgqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v93A (A:)
    mkirdllkarrgplfsfeffppkdpegeealfrtleelkafrpafvsitygamgstrers
    vawaqriqslglnplahltvagqsrkevaevlhrfvesgvenllalrgdpprgervfrph
    pegfryaaelvalirerygdrvsvggaaypeghpesesleadlrhfkakveagldfaitq
    lffnnahyfgflerarragigipilpgimpvtsyrqlrrftevcgasipgpllaklerhq
    ddpkavleigvehavrqvaelleagvegvhfytlnkspatrmvlerlglrpa