PDB entry 1v92

View 1v92 on RCSB PDB site
Description: Solution structure of the UBA domain from p47, a major cofactor of the AAA ATPase p97
Class: recombination
Keywords: 3-helix bundle, RECOMBINATION
Deposited on 2004-01-19, released 2004-04-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: NSFL1 cofactor p47
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O35987 (0-45)
  Domains in SCOPe 2.06: d1v92a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v92A (A:)
  maeerqdalrefvavtgaeedrarfflesagwdlqialasfyedgg