PDB entry 1v92

View 1v92 on RCSB PDB site
Description: solution structure of the uba domain from p47, a major cofactor of the aaa atpase p97
Deposited on 2004-01-19, released 2004-04-06
The last revision prior to the SCOP 1.71 freeze date was dated 2004-04-06, with a file datestamp of 2004-04-06.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1v92a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v92A (A:)
    maeerqdalrefvavtgaeedrarfflesagwdlqialasfyedgg