PDB entry 1v92

View 1v92 on RCSB PDB site
Description: Solution structure of the UBA domain from p47, a major cofactor of the AAA ATPase p97
Class: recombination
Keywords: 3-helix bundle, RECOMBINATION
Deposited on 2004-01-19, released 2004-04-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NSFL1 cofactor p47
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1v92a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v92A (A:)
    maeerqdalrefvavtgaeedrarfflesagwdlqialasfyedgg