PDB entry 1v90

View 1v90 on RCSB PDB site
Description: Solution structure by NMR means of delta-paluIT1-NH2
Deposited on 2004-01-19, released 2005-03-29
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Delta-palutoxin IT1
    Species: Paracoelotes luctuosus [TaxId:185217]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1v90A (A:)
    gclgegekcadwsgpsccdgfycscrsmpycrcrnns