PDB entry 1v8z

View 1v8z on RCSB PDB site
Description: X-ray crystal structure of the Tryptophan Synthase b2 Subunit from Hyperthermophile, Pyrococcus furiosus
Class: lyase
Keywords: beta+alpha, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, LYASE
Deposited on 2004-01-15, released 2005-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.208
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: TrpB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v8za1
  • Chain 'B':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: TrpB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v8zb_
  • Chain 'C':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: TrpB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v8zc_
  • Chain 'D':
    Compound: Tryptophan synthase beta chain 1
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: TrpB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v8zd_
  • Heterogens: NA, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v8zA (A:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsgnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8zA (A:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v8zB (B:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsgnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8zB (B:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsgn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v8zC (C:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsgnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8zC (C:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsgn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1v8zD (D:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlkvsgnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8zD (D:)
    mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
    ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
    lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
    yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
    ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
    ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
    srdeiiivnlsgrgdkdldivlvsg