PDB entry 1v8v

View 1v8v on RCSB PDB site
Description: Crystal structure analysis of the ADP-ribose pyrophosphatase of E86Q mutant, complexed with ADP-ribose and Mg
Class: hydrolase
Keywords: MutT family, nudix motif, loop-helix-loop, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, HYDROLASE
Deposited on 2004-01-15, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.217
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribose pyrophosphatase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84CU3
      • engineered (85)
    Domains in SCOPe 2.07: d1v8va_
  • Heterogens: MG, APR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v8vA (A:)
    mgrvyyggvertylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavgla
    pleipagliepgedpleaarrelaeqtglsgdltylfsyfvspgftdekthvflaenlke
    veahpdedeaievvwmrpeealerhqrgevefsatglvgvlyyhaflrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8vA (A:)
    rtylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipaglie
    pgedpleaarrelaeqtglsgdltylfsyfvspgftdekthvflaenlkeveaeaievvw
    mrpeealerhqrgevefsatglvgvlyyhaflrg