PDB entry 1v8v

View 1v8v on RCSB PDB site
Description: Crystal structure analysis of the ADP-ribose pyrophosphatase of E86Q mutant, complexed with ADP-ribose and Mg
Deposited on 2004-01-15, released 2004-10-19
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-19, with a file datestamp of 2004-10-19.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.217
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1v8va_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v8vA (A:)
    mgrvyyggvertylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavgla
    pleipagliepgedpleaarrelaeqtglsgdltylfsyfvspgftdekthvflaenlke
    veahpdedeaievvwmrpeealerhqrgevefsatglvgvlyyhaflrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8vA (A:)
    rtylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipaglie
    pgedpleaarrelaeqtglsgdltylfsyfvspgftdekthvflaenlkeveaeaievvw
    mrpeealerhqrgevefsatglvgvlyyhaflrg