PDB entry 1v8u

View 1v8u on RCSB PDB site
Description: Crystal structure analysis of the ADP-ribose pyrophosphatase of E82Q mutant with SO4 and Mg
Class: hydrolase
Keywords: MutT family, nudix motif, loop-helix-loop, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, HYDROLASE
Deposited on 2004-01-15, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.203
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribose pyrophosphatase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84CU3
      • engineered (81)
    Domains in SCOPe 2.07: d1v8ua_
  • Heterogens: MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1v8uA (A:)
mgrvyyggvertylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavgla
pleipagliepgedpleaarrqlaeetglsgdltylfsyfvspgftdekthvflaenlke
veahpdedeaievvwmrpeealerhqrgevefsatglvgvlyyhaflrgr

    Sequence, based on observed residues (ATOM records): (download) 
    >1v8uA (A:)
rtylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipaglie
pgedpleaarrqlaeetglsgdltylfsyfvspgftdekthvflaenlkeveaeaievvw
mrpeealerhqrgevefsatglvgvlyyhaflrg