PDB entry 1v8t

View 1v8t on RCSB PDB site
Description: Crystal Structure analysis of the ADP-ribose pyrophosphatase complexed with ribose-5'-phosphate and Zn
Class: hydrolase
Keywords: Nudix motif, MutT family, loop-helix-loop, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, HYDROLASE
Deposited on 2004-01-14, released 2004-10-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.22
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribose pyrophosphatase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1v8ta_
  • Heterogens: R5P, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v8tA (A:)
    mgrvyyggvertylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavgla
    pleipagliepgedpleaarrelaeetglsgdltylfsyfvspgftdekthvflaenlke
    veahpdedeaievvwmrpeealerhqrgevefsatglvgvlyyhaflrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8tA (A:)
    rtylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipaglie
    pgedpleaarrelaeetglsgdltylfsyfvspgftdekthvflaenlkeveaaievvwm
    rpeealerhqrgevefsatglvgvlyyhaflr