PDB entry 1v8s

View 1v8s on RCSB PDB site
Description: Crystal structure analusis of the ADP-ribose pyrophosphatase complexed with AMP and Mg
Class: hydrolase
Keywords: nudix motif, helix-loop-helix, MutT family, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2004-01-14, released 2004-10-19
The last revision prior to the SCOP 1.75 freeze date was dated 2004-10-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.199
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribose pyrophosphatase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1v8sa_
  • Heterogens: MG, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v8sA (A:)
    mgrvyyggvertylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavgla
    pleipagliepgedpleaarrelaeetglsgdltylfsyfvspgftdekthvflaenlke
    veahpdedeaievvwmrpeealerhqrgevefsatglvgvlyyhaflrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8sA (A:)
    rtylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipaglie
    pgedpleaarrelaeetglsgdltylfsyfvspgftdekthvflaenlkeveaievvwmr
    peealerhqrgevefsatglvgvlyyhaflrg