PDB entry 1v8p

View 1v8p on RCSB PDB site
Description: Crystal structure of PAE2754 from Pyrobaculum aerophilum
Class: structural genomics, unknown function
Keywords: PIN-domain, tetramer, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2004-01-12, released 2004-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: 0.25
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PAE2754
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: PAE2754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZUJ3 (Start-157)
      • engineered (26)
    Domains in SCOPe 2.07: d1v8pa_
  • Chain 'B':
    Compound: hypothetical protein PAE2754
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: PAE2754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZUJ3 (25-157)
      • engineered (26)
      • expression tag (25)
      • expression tag (25)
    Domains in SCOPe 2.07: d1v8pb1, d1v8pb2
  • Chain 'C':
    Compound: hypothetical protein PAE2754
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: PAE2754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZUJ3 (23-157)
      • engineered (26)
      • expression tag (23)
      • expression tag (23)
    Domains in SCOPe 2.07: d1v8pc1, d1v8pc2
  • Chain 'D':
    Compound: hypothetical protein PAE2754
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: PAE2754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZUJ3 (25-157)
      • engineered (26)
      • expression tag (25)
      • expression tag (25)
    Domains in SCOPe 2.07: d1v8pd1, d1v8pd2
  • Chain 'E':
    Compound: hypothetical protein PAE2754
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: PAE2754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZUJ3 (Start-157)
      • engineered (26)
    Domains in SCOPe 2.07: d1v8pe_
  • Chain 'F':
    Compound: hypothetical protein PAE2754
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: PAE2754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZUJ3 (25-157)
      • expression tag (14-24)
      • engineered (26)
      • expression tag (14-25)
      • expression tag (25)
    Domains in SCOPe 2.07: d1v8pf1, d1v8pf2
  • Chain 'G':
    Compound: hypothetical protein PAE2754
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: PAE2754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZUJ3 (25-157)
      • engineered (26)
      • expression tag (25)
      • expression tag (25)
    Domains in SCOPe 2.07: d1v8pg1, d1v8pg2
  • Chain 'H':
    Compound: hypothetical protein PAE2754
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: PAE2754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZUJ3 (Start-157)
      • engineered (26)
    Domains in SCOPe 2.07: d1v8ph_
  • Chain 'I':
    Compound: hypothetical protein PAE2754
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: PAE2754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZUJ3 (Start-157)
      • engineered (26)
    Domains in SCOPe 2.07: d1v8pi_
  • Chain 'J':
    Compound: hypothetical protein PAE2754
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: PAE2754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZUJ3 (Start-157)
      • engineered (26)
    Domains in SCOPe 2.07: d1v8pj_
  • Chain 'K':
    Compound: hypothetical protein PAE2754
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: PAE2754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZUJ3 (Start-157)
      • engineered (26)
    Domains in SCOPe 2.07: d1v8pk_
  • Chain 'L':
    Compound: hypothetical protein PAE2754
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: PAE2754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZUJ3 (Start-157)
      • engineered (26)
    Domains in SCOPe 2.07: d1v8pl_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v8pA (A:)
    msyyhhhhhhdydipttenlyfqgamaveylvdasalyalaahydkwikhreklailhlt
    iyeagnalwkearlgrvdwaaasrhlkkvlssfkvledppldevlrvavergltfydasy
    ayvaessglvlvtqdrellaktkgaidvetllvrlaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8pA (A:)
    aveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaasrhl
    kkvlssfkvledppldevlrvavergltfydasyayvaessglvlvtqdrellaktkgai
    dvetllvrlaaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v8pB (B:)
    msyyhhhhhhdydipttenlyfqgamaveylvdasalyalaahydkwikhreklailhlt
    iyeagnalwkearlgrvdwaaasrhlkkvlssfkvledppldevlrvavergltfydasy
    ayvaessglvlvtqdrellaktkgaidvetllvrlaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8pB (B:)
    maveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaasrh
    lkkvlssfkvledppldevlrvavergltfydasyayvaessglvlvtqdrellaktkga
    idvetllvrlaaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v8pC (C:)
    msyyhhhhhhdydipttenlyfqgamaveylvdasalyalaahydkwikhreklailhlt
    iyeagnalwkearlgrvdwaaasrhlkkvlssfkvledppldevlrvavergltfydasy
    ayvaessglvlvtqdrellaktkgaidvetllvrlaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8pC (C:)
    gamaveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaas
    rhlkkvlssfkvledppldevlrvavergltfydasyayvaessglvlvtqdrellaktk
    gaidvetllvrlaaq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1v8pD (D:)
    msyyhhhhhhdydipttenlyfqgamaveylvdasalyalaahydkwikhreklailhlt
    iyeagnalwkearlgrvdwaaasrhlkkvlssfkvledppldevlrvavergltfydasy
    ayvaessglvlvtqdrellaktkgaidvetllvrlaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8pD (D:)
    maveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaasrh
    lkkvlssfkvledppldevlrvavergltfydasyayvaessglvlvtqdrellaktkga
    idvetllvrlaaq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1v8pE (E:)
    msyyhhhhhhdydipttenlyfqgamaveylvdasalyalaahydkwikhreklailhlt
    iyeagnalwkearlgrvdwaaasrhlkkvlssfkvledppldevlrvavergltfydasy
    ayvaessglvlvtqdrellaktkgaidvetllvrlaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8pE (E:)
    aveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaasrhl
    kkvlssfkvledppldevlrvavergltfydasyayvaessglvlvtqdrellaktkgai
    dvetllvrlaaq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1v8pF (F:)
    msyyhhhhhhdydipttenlyfqgamaveylvdasalyalaahydkwikhreklailhlt
    iyeagnalwkearlgrvdwaaasrhlkkvlssfkvledppldevlrvavergltfydasy
    ayvaessglvlvtqdrellaktkgaidvetllvrlaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8pF (F:)
    pttenlyfqgamaveylvdasalyalaahydkwikhreklailhltiyeagnalwkearl
    grvdwaaasrhlkkvlssfkvledppldevlrvavergltfydasyayvaessglvlvtq
    drellaktkgaidvetllvrlaaq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1v8pG (G:)
    msyyhhhhhhdydipttenlyfqgamaveylvdasalyalaahydkwikhreklailhlt
    iyeagnalwkearlgrvdwaaasrhlkkvlssfkvledppldevlrvavergltfydasy
    ayvaessglvlvtqdrellaktkgaidvetllvrlaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8pG (G:)
    maveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaasrh
    lkkvlssfkvledppldevlrvavergltfydasyayvaessglvlvtqdrellaktkga
    idvetllvrlaaq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1v8pH (H:)
    msyyhhhhhhdydipttenlyfqgamaveylvdasalyalaahydkwikhreklailhlt
    iyeagnalwkearlgrvdwaaasrhlkkvlssfkvledppldevlrvavergltfydasy
    ayvaessglvlvtqdrellaktkgaidvetllvrlaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8pH (H:)
    aveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaasrhl
    kkvlssfkvledppldevlrvavergltfydasyayvaessglvlvtqdrellaktkgai
    dvetllvrlaaq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1v8pI (I:)
    msyyhhhhhhdydipttenlyfqgamaveylvdasalyalaahydkwikhreklailhlt
    iyeagnalwkearlgrvdwaaasrhlkkvlssfkvledppldevlrvavergltfydasy
    ayvaessglvlvtqdrellaktkgaidvetllvrlaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8pI (I:)
    aveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaasrhl
    kkvlssfkvledppldevlrvavergltfydasyayvaessglvlvtqdrellaktkgai
    dvetllvrlaaq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1v8pJ (J:)
    msyyhhhhhhdydipttenlyfqgamaveylvdasalyalaahydkwikhreklailhlt
    iyeagnalwkearlgrvdwaaasrhlkkvlssfkvledppldevlrvavergltfydasy
    ayvaessglvlvtqdrellaktkgaidvetllvrlaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8pJ (J:)
    aveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaasrhl
    kkvlssfkvledppldevlrvavergltfydasyayvaessglvlvtqdrellaktkgai
    dvetllvrlaaq
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1v8pK (K:)
    msyyhhhhhhdydipttenlyfqgamaveylvdasalyalaahydkwikhreklailhlt
    iyeagnalwkearlgrvdwaaasrhlkkvlssfkvledppldevlrvavergltfydasy
    ayvaessglvlvtqdrellaktkgaidvetllvrlaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8pK (K:)
    aveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaasrhl
    kkvlssfkvledppldevlrvavergltfydasyayvaessglvlvtqdrellaktkgai
    dvetllvrlaaq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1v8pL (L:)
    msyyhhhhhhdydipttenlyfqgamaveylvdasalyalaahydkwikhreklailhlt
    iyeagnalwkearlgrvdwaaasrhlkkvlssfkvledppldevlrvavergltfydasy
    ayvaessglvlvtqdrellaktkgaidvetllvrlaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8pL (L:)
    aveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaasrhl
    kkvlssfkvledppldevlrvavergltfydasyayvaessglvlvtqdrellaktkgai
    dvetllvrlaaq