PDB entry 1v8n

View 1v8n on RCSB PDB site
Description: Crystal structure analysis of the ADP-ribose pyrophosphatase complexed with Zn
Class: hydrolase
Keywords: nudix motif, MutT family, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, HYDROLASE
Deposited on 2004-01-12, released 2004-10-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.221
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribose pyrophosphatase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1v8na_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v8nA (A:)
    mgrvyyggvertylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavgla
    pleipagliepgedpleaarrelaeetglsgdltylfsyfvspgftdekthvflaenlke
    veahpdedeaievvwmrpeealerhqrgevefsatglvgvlyyhaflrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8nA (A:)
    rtylyrgrilnlalegryeivehkpavavialregrmlfvrqmrpavglapleipaglie
    pgedpleaarrelaeetglsgdltylfsyfvspgftdekthvflaenlkeveievvwmrp
    eealerhqrgevefsatglvgvlyyhaflr