PDB entry 1v8j

View 1v8j on RCSB PDB site
Description: The Crystal Structure of the Minimal Functional Domain of the Microtubule Destabilizer KIF2C Complexed with Mg-ADP
Class: structural protein
Keywords: Kinesin-Like Protein, Microtubule Destabilizer, STRUCTURAL PROTEIN
Deposited on 2004-01-09, released 2004-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.24 Å
R-factor: 0.248
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein KIF2C
    Species: Mus musculus [TaxId:10090]
    Gene: KIF2C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q922S8 (Start-402)
      • expression tag (403)
    Domains in SCOPe 2.07: d1v8ja1, d1v8ja2
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v8jA (A:)
    svrrkscivkemekmknkreekraqnselrikraqeydssfpnwefarmikefrvtmecs
    pltvtdpieehricvcvrkrplnkqelakkeidvisvpskclllvhepklkvdltkylen
    qafcfdfafdetasnevvyrftarplvqtifeggkatcfaygqtgsgkthtmggdlsgks
    qnaskgiyamasrdvfllknqpryrnlnlevyvtffeiyngkvfdllnkkaklrvledsr
    qqvqvvglqeylvtcaddvikminmgsacrtsgqtfansnssrshacfqillrtkgrlhg
    kfslvdlagnergadtssadrqtrmegaeinksllalkeciralgqnkahtpfreskltq
    vlrdsfigensrtcmiamispgissceytlntlryadrvkelshhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8jA (A:)
    pnwefarmikefrvtmecspltpieehricvcvrkrplnkqelakkeidvisvpskclll
    vhepklkvdltkylenqafcfdfafdetasnevvyrftarplvqtifeggkatcfaygqt
    gsgkthtmggdqnaskgiyamasrdvfllknqpryrnlnlevyvtffeiyngkvfdllnk
    kaklrvledsrqqvqvvglqeylvtcaddvikminmgsacrtsgnsnssrshacfqillr
    tkgrlhgkfslvdlagnerrqtrmegaeinksllalkeciralgqfreskltqvlrdsfi
    gensrtcmiamispgissceytlntlryadrvkelsh