PDB entry 1v8h

View 1v8h on RCSB PDB site
Description: Crystal structure of TT0351 protein from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: lithotrophic sulfur oxidation, unknown function, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-01-09, released 2005-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.211
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sulfur oxidation protein SoxZ
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v8ha1
  • Chain 'B':
    Compound: sulfur oxidation protein SoxZ
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v8hb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v8hA (A:)
    pfrtiarlnpakpkageefrlqvvaqhpnepgtrrdaegklipakyinlvevyfegekva
    earpgpstsanplyafkfkaekagtftiklkdtdgdtgeasvklelv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8hA (A:)
    pfrtiarlnpakpkageefrlqvvaqhpnepgtrrdaegklipakyinlvevyfegekva
    earpgpstsanplyafkfkaekagtftiklkdtdgdtgeasvklel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v8hB (B:)
    pfrtiarlnpakpkageefrlqvvaqhpnepgtrrdaegklipakyinlvevyfegekva
    earpgpstsanplyafkfkaekagtftiklkdtdgdtgeasvklelv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8hB (B:)
    pfrtiarlnpakpkageefrlqvvaqhpnepgtrrdaegklipakyinlvevyfegekva
    earpgpstsanplyafkfkaekagtftiklkdtdgdtgeasvklel