PDB entry 1v8g

View 1v8g on RCSB PDB site
Description: Crystal structure of anthranilate phosphoribosyltransferase (TrpD) from Thermus thermophilus HB8
Class: transferase
Keywords: Tryptophan biosynthesis, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, TRANSFERASE
Deposited on 2004-01-08, released 2004-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.212
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anthranilate phosphoribosyltransferase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v8ga1, d1v8ga2
  • Chain 'B':
    Compound: Anthranilate phosphoribosyltransferase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v8gb1, d1v8gb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v8gA (A:)
    mdavkkailgevleeeeayevmralmagevspvraagllvalslrgerpheiaamaramr
    eaarplrvhrrplldivgtggdgkglmnlstlaalvaaaggvavakhgnraassragsad
    llealgvdleappervgeaieelgfgflfarvfhpamrhvapvraelgvrtvfnllgplt
    npagadayvlgvfspewlapmaealerlgarglvvhgegadelvlgenrvvevgkgayal
    tpeevglkraplealkgggpeenaalarrllkgeekgpladavalaagagfyaagktpsl
    kegvalarevlasgeayllleryvaflra
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v8gB (B:)
    mdavkkailgevleeeeayevmralmagevspvraagllvalslrgerpheiaamaramr
    eaarplrvhrrplldivgtggdgkglmnlstlaalvaaaggvavakhgnraassragsad
    llealgvdleappervgeaieelgfgflfarvfhpamrhvapvraelgvrtvfnllgplt
    npagadayvlgvfspewlapmaealerlgarglvvhgegadelvlgenrvvevgkgayal
    tpeevglkraplealkgggpeenaalarrllkgeekgpladavalaagagfyaagktpsl
    kegvalarevlasgeayllleryvaflra