PDB entry 1v8f

View 1v8f on RCSB PDB site
Description: Crystal Structure of Pantoate-beta-Alanine (Pantothenate Synthetase) from Thermus Thermophilus HB8
Deposited on 2004-01-08, released 2004-01-20
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-20, with a file datestamp of 2004-01-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1v8fa_
  • Chain 'B':
    Domains in SCOP 1.67: d1v8fb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v8fA (A:)
    mrtvstvaelraalpregvgfvptmgylhrghlalverarrenpfvvvsvfvnplqfgpg
    edyhryprdlerdrallqeagvdllfapgveemypegfatrvqvegpltalwegavrpgh
    fqgvatvvarlfllvqpqrayfgekdyqqllvvrrmvrdlgfpvevvgvptvreedglal
    ssrnvylspetrkkapvlyrallamrevagqggsvaealrageealravpefrkdylaiv
    hpetllplsdwvagargivagrfpearlidnlevyp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v8fB (B:)
    mrtvstvaelraalpregvgfvptmgylhrghlalverarrenpfvvvsvfvnplqfgpg
    edyhryprdlerdrallqeagvdllfapgveemypegfatrvqvegpltalwegavrpgh
    fqgvatvvarlfllvqpqrayfgekdyqqllvvrrmvrdlgfpvevvgvptvreedglal
    ssrnvylspetrkkapvlyrallamrevagqggsvaealrageealravpefrkdylaiv
    hpetllplsdwvagargivagrfpearlidnlevyp