PDB entry 1v8f

View 1v8f on RCSB PDB site
Description: Crystal Structure of Pantoate-beta-Alanine (Pantothenate Synthetase) from Thermus Thermophilus HB8
Class: ligase
Keywords: Ligase, Rossmann Fold, Dimer, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-01-08, released 2004-01-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pantoate-beta-alanine ligase
    Species: Thermus thermophilus [TaxId:274]
    Gene: panC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1v8fa_
  • Chain 'B':
    Compound: Pantoate-beta-alanine ligase
    Species: Thermus thermophilus [TaxId:274]
    Gene: panC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1v8fb_
  • Heterogens: CL, 144, P6G, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v8fA (A:)
    mrtvstvaelraalpregvgfvptmgylhrghlalverarrenpfvvvsvfvnplqfgpg
    edyhryprdlerdrallqeagvdllfapgveemypegfatrvqvegpltalwegavrpgh
    fqgvatvvarlfllvqpqrayfgekdyqqllvvrrmvrdlgfpvevvgvptvreedglal
    ssrnvylspetrkkapvlyrallamrevagqggsvaealrageealravpefrkdylaiv
    hpetllplsdwvagargivagrfpearlidnlevyp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v8fB (B:)
    mrtvstvaelraalpregvgfvptmgylhrghlalverarrenpfvvvsvfvnplqfgpg
    edyhryprdlerdrallqeagvdllfapgveemypegfatrvqvegpltalwegavrpgh
    fqgvatvvarlfllvqpqrayfgekdyqqllvvrrmvrdlgfpvevvgvptvreedglal
    ssrnvylspetrkkapvlyrallamrevagqggsvaealrageealravpefrkdylaiv
    hpetllplsdwvagargivagrfpearlidnlevyp