PDB entry 1v8e

View 1v8e on RCSB PDB site
Description: Crystal Structure of Glycerophosphoryl Diester Phosphodiesterase from Thermus thermophilus HB8
Class: hydrolase
Keywords: Glycerophosphoryl diester phosphodiesterase, Glycerophosphodiester phosphodiesterase, Thermus thermophilus, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE
Deposited on 2004-01-05, released 2005-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.205
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative glycerophosphoryl diester phosphodiesterase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • GB YP_145380 (Start-223)
    Domains in SCOPe 2.07: d1v8ea1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v8eA (A:)
    mtafrqrplrlghrgaplkakentlesfrlaleagldgveldvwptrdgvfavrhdpdtp
    lgpvfqvdyadlkaqepdlprleevlalkeafpqavfnvelksfpglgeeaarrlaallr
    gregvwvssfdplallalrkaapglplgflmaedhsallpclgveavhphhalvteeava
    gwrkrglfvvawtvneegearrllalgldgligdrpevllplgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8eA (A:)
    plrlghrgaplkakentlesfrlaleagldgveldvwptrdgvfavrhdpdtplgpvfqv
    dyadlkaqepdlprleevlalkeafpqavfnvelksfpglgeeaarrlaallrgregvwv
    ssfdplallalrkaapglplgflmaedhsallpclgveavhphhalvteeavagwrkrgl
    fvvawtvneegearrllalgldgligdrpevllplgg