PDB entry 1v8d

View 1v8d on RCSB PDB site
Description: Crystal structure of the conserved hypothetical protein TT1679 from Thermus thermophilus
Class: structural genomics, unknown function
Keywords: X-ray craytallography, hypothetical protein, Thermus thermophilus, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-01-05, released 2004-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.189
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein (TT1679)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v8da_
  • Chain 'B':
    Compound: hypothetical protein (TT1679)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v8db_
  • Chain 'C':
    Compound: hypothetical protein (TT1679)
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v8dc_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v8dA (A:)
    mrrgsgnperpslsrdglrvpppcpgkrgpghfsgyhggmegirraaqraaeeflqafpm
    apgslfvlggstsevlgervgtrpsleaahavlegllppllergvhvavqacehlnralv
    veretarafgkeevavfphpkaggakataaflrfrdpvmveslkaqahggmdiggvligm
    hlrpvavplrlsvrkigeavllaaktrpklvggaravytreemlkkleeflpkpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8dA (A:)
    megirraaqraaeeflqafpmapgslfvlggstsevlgtrpsleaahavlegllppller
    gvhvavqacehlnralvveretarafgkeevavfphpkaggakataaflrfrdpvmvesl
    kaqahggmdiggvligmhlrpvavplrlsvrkigeavllaaktrpklvggaravytreem
    lkkleeflp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v8dB (B:)
    mrrgsgnperpslsrdglrvpppcpgkrgpghfsgyhggmegirraaqraaeeflqafpm
    apgslfvlggstsevlgervgtrpsleaahavlegllppllergvhvavqacehlnralv
    veretarafgkeevavfphpkaggakataaflrfrdpvmveslkaqahggmdiggvligm
    hlrpvavplrlsvrkigeavllaaktrpklvggaravytreemlkkleeflpkpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8dB (B:)
    megirraaqraaeeflqafpmapgslfvlggstsevltrpsleaahavlegllppllerg
    vhvavqacehlnralvveretarafgkeevavfphpkaggakataaflrfrdpvmveslk
    aqahggmdiggvligmhlrpvavplrlsvrkigeavllaaktrpklvggaravytreeml
    kklee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v8dC (C:)
    mrrgsgnperpslsrdglrvpppcpgkrgpghfsgyhggmegirraaqraaeeflqafpm
    apgslfvlggstsevlgervgtrpsleaahavlegllppllergvhvavqacehlnralv
    veretarafgkeevavfphpkaggakataaflrfrdpvmveslkaqahggmdiggvligm
    hlrpvavplrlsvrkigeavllaaktrpklvggaravytreemlkkleeflpkpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8dC (C:)
    megirraaqraaeeflqafpmapgslfvlggstsevlgerrpsleaahavlegllpplle
    rgvhvavqacehlnralvveretarafgkeevavfphpkaggakataaflrfrdpvmves
    lkaqahggmdiggvligmhlrpvavplrlsvrkigeavllaaktrpklvggaravytree
    mlkkleef