PDB entry 1v8c

View 1v8c on RCSB PDB site
Description: Crystal Structure of MoaD related protein from Thermus thermophilus HB8
Deposited on 2004-01-05, released 2004-01-20
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-20, with a file datestamp of 2004-01-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.221
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v8cA (A:)
    pkvnlyatfrdltgksqlelpgatvgevlenlvraypalkeelfegeglaervsvflegr
    dvrylqglstplspgatldlfppvagggfertfgafppwlleryleewggtregegvyrl
    pgavvrfreveplkvgslsipqlrvevegeeaerwferiafaasrggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8cA (A:)
    pkvnlyatfrdltgksqlelpgatvgevlenlvraypalkeelfegeglaervsvflegr
    dvrylqglstplspgatldlfppvagggfertfgafppwlleryleewggtregegvyrl
    pgavvrfreveplkvgslsipqlrvevegeeaerwferiafaasr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v8cB (B:)
    pkvnlyatfrdltgksqlelpgatvgevlenlvraypalkeelfegeglaervsvflegr
    dvrylqglstplspgatldlfppvagggfertfgafppwlleryleewggtregegvyrl
    pgavvrfreveplkvgslsipqlrvevegeeaerwferiafaasrggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8cB (B:)
    pkvnlyatfrdltgksqlelpgatvgevlenlvraypalkeelfegeglaervsvflegr
    dvrylqglstplspgatldlfppgfertfgafppwlleryleewggtregegvyrlpgav
    vrfreveplkvgslsipqlrvevegeeaerwferiafaas
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v8cC (C:)
    pkvnlyatfrdltgksqlelpgatvgevlenlvraypalkeelfegeglaervsvflegr
    dvrylqglstplspgatldlfppvagggfertfgafppwlleryleewggtregegvyrl
    pgavvrfreveplkvgslsipqlrvevegeeaerwferiafaasrggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8cC (C:)
    pkvnlyatfrdltgksqlelpgatvgevlenlvraypalkeelfegeglaervsvflegr
    dvrylqglstplspgatldlfppvagggfertfgafppwlleryleewggtregegvyrl
    pgavvrfreveplkvgslsipqlrvevegeeaerwferiafaasr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1v8cD (D:)
    pkvnlyatfrdltgksqlelpgatvgevlenlvraypalkeelfegeglaervsvflegr
    dvrylqglstplspgatldlfppvagggfertfgafppwlleryleewggtregegvyrl
    pgavvrfreveplkvgslsipqlrvevegeeaerwferiafaasrggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8cD (D:)
    pkvnlyatfrdltgksqlelpgatvgevlenlvraypalkeelfegeglaervsvflegr
    dvrylqglstplspgatldlfppvagggfertfgafppwlleryleewggtregegvyrl
    pgavvrfreveplkvgslsipqlrvevegeeaerwferiafaasr