PDB entry 1v8a

View 1v8a on RCSB PDB site
Description: Structure of Hydroxyethylthiazole kinase protein from pyrococcus horikoshii OT3
Class: transferase
Keywords: Alpha-beta, ATP binding, Kinase, Transferase, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-01-01, released 2004-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.161
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydroxyethylthiazole kinase
    Species: Pyrococcus horikoshii OT3 [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v8aa_
  • Heterogens: CL, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v8aA (A:)
    mkfiiealkrvrerrplvhnitnfvvmnttanallalgaspvmahaeeeleemirladav
    vinigtldsgwrrsmvkateianelgkpivldpvgagatkfrtrvsleilsrgvdvlkgn
    fgeisallgeegktrgvdsleygeeeakkltmnaarefnttvavtgavdyvsdgrrtfav
    ynghellgrvtgtgcmvaaltgafvavteplkattsalvtfgiaaekayeeakypgsfhv
    klydwlyrinenvirtyakvrevel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8aA (A:)
    mkfiiealkrvrerrplvhnitnfvvmnttanallalgaspvmahaeeeleemirladav
    vinigtldsgwrrsmvkateianelgkpivldpvgagatkfrtrvsleilsrgvdvlkgn
    fgeisallgeeggeeeakkltmnaarefnttvavtgavdyvsdgrrtfavynghellgrv
    tgtgcmvaaltgafvavteplkattsalvtfgiaaekayeeakypgsfhvklydwlyrin
    envirtyakvreve