PDB entry 1v89

View 1v89 on RCSB PDB site
Description: Solution Structure of the Pleckstrin Homology Domain of Human KIAA0053 Protein
Class: signaling protein
Keywords: pleckstrin homology domain, phosphatidylinositol binding, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2003-12-29, released 2004-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein KIAA0053
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA ha01417
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42331 (7-111)
      • cloning artifact (0-6)
      • cloning artifact (112-117)
    Domains in SCOPe 2.07: d1v89a1, d1v89a2, d1v89a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v89A (A:)
    gssgssgpikmgwlkkqrsivknwqqryfvlraqqlyyykdeedtkpqgcmylpgctike
    iatnpeeagkfvfeiipaswdqnrmgqdsyvlmassqaemeewvkflrrvagsgpssg