PDB entry 1v88

View 1v88 on RCSB PDB site
Description: Solution Structure of the Pleckstrin Homology Domain of Oxysterol-Binding Protein-Related Protein 8 (KIAA1451 Protein)
Class: lipid transport
Keywords: vesicle transport, oxysterol-binding protein-related protein 8, pleckstrin homology domain, phosphatidylinositol binding, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIPID TRANSPORT
Deposited on 2003-12-29, released 2004-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxysterol binding protein-related protein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA bg00289
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BZF1 (7-123)
      • cloning artifact (0-6)
      • cloning artifact (124-129)
    Domains in SCOPe 2.07: d1v88a1, d1v88a2, d1v88a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v88A (A:)
    gssgssgivmadwlkirgtlkswtklwcvlkpgvlliyktqkngqwvgtvllnaceiier
    pskkdgfcfklfhpleqsiwavkgpkgeavgsitqplpssyliiratsesdgrcwmdale
    lalksgpssg