PDB entry 1v86

View 1v86 on RCSB PDB site
Description: solution structure of the ubiquitin domain from mouse d7wsu128e protein
Deposited on 2003-12-29, released 2004-06-29
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-29, with a file datestamp of 2004-06-29.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1v86a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v86A (A:)
  gssgssgdagggvgkelvdlkiiwnktkhdvkvpldstgselkqkihsitglppamqkvm
  ykglvpedktlreikvtsgakimvvgstisgpssg