PDB entry 1v86

View 1v86 on RCSB PDB site
Description: Solution structure of the ubiquitin domain from mouse D7Wsu128e protein
Class: structural genomics, unknown function
Keywords: ubiquitin fold, structural genomics, D7Wsu128e protein, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2003-12-29, released 2004-06-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA segment, Chr 7, Wayne State University 128, expressed
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 5730563G13
    Database cross-references and differences (RAF-indexed):
    • GB NP_613055 (7-88)
      • cloning artifact (0-6)
      • cloning artifact (89-94)
    Domains in SCOPe 2.08: d1v86a1, d1v86a2, d1v86a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1v86A (A:)
gssgssgdagggvgkelvdlkiiwnktkhdvkvpldstgselkqkihsitglppamqkvm
ykglvpedktlreikvtsgakimvvgstisgpssg