PDB entry 1v85

View 1v85 on RCSB PDB site
Description: Sterile alpha motif (SAM) domain of mouse bifunctional apoptosis regulator
Deposited on 2003-12-29, released 2005-01-25
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: similar to ring finger protein 36
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN CDNA 3010001A07
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CXY3 (7-84)
      • cloning artifact (0-6)
      • cloning artifact (85-90)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1v85A (A:)
    gssgssgehgllvhkavdkwtteevvlwleqlgpwaslyrdrflservngrllltlteee
    fsrapytiensshrrviltelervrsgpssg