PDB entry 1v84

View 1v84 on RCSB PDB site
Description: Crystal structure of human GlcAT-P in complex with N-acetyllactosamine, Udp, and Mn2+
Class: transferase
Keywords: TRANSFERASE, glycoprotein, glycocyltransferase, HNK-1 epitope
Deposited on 2003-12-27, released 2004-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.205
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v84a_
  • Chain 'B':
    Compound: Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P2W7 (1-252)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1v84b1, d1v84b2
  • Heterogens: MN, TLA, UDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v84A (A:)
    alptihvvtptysrpvqkaeltrmantllhvpnlhwlvvedaprrtpltarllrdtglny
    thlhvetprnyklrgdardpriprgtmqrnlalrwlretfprnssqpgvvyfadddntys
    lelfeemrstrrvsvwpvafvgglryeaprvngagkvvrwktvfdphrpfaidmagfavn
    lrlilqrsqayfklrgvkggyqessllrelvtlndlepkaanctkilvwhtrtekpvlvn
    egkkgftdpsvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v84A (A:)
    lptihvvtptysrpvqkaeltrmantllhvpnlhwlvvedaprrtpltarllrdtglnyt
    hlhvetprnyklriprgtmqrnlalrwlretfprnssqpgvvyfadddntyslelfeemr
    strrvsvwpvafvgglryeaprvngagkvvrwktvfdphrpfaidmagfavnlrlilqrs
    qayfklrgvkggyqessllrelvtlndlepkaanctkilvwhtrtekpvlvnegkkgftd
    psvei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v84B (B:)
    alptihvvtptysrpvqkaeltrmantllhvpnlhwlvvedaprrtpltarllrdtglny
    thlhvetprnyklrgdardpriprgtmqrnlalrwlretfprnssqpgvvyfadddntys
    lelfeemrstrrvsvwpvafvgglryeaprvngagkvvrwktvfdphrpfaidmagfavn
    lrlilqrsqayfklrgvkggyqessllrelvtlndlepkaanctkilvwhtrtekpvlvn
    egkkgftdpsvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v84B (B:)
    alptihvvtptysrpvqkaeltrmantllhvpnlhwlvvedaprrtpltarllrdtglny
    thlhvetprnyiprgtmqrnlalrwlretfprnssqpgvvyfadddntyslelfeemrst
    rrvsvwpvafvgglryeaprvngagkvvrwktvfdphrpfaidmagfavnlrlilqrsqa
    yfklrgvkggyqessllrelvtlndlepkaanctkilvwhtrtekpvlvnegkkgftdps
    vei