PDB entry 1v7z

View 1v7z on RCSB PDB site
Description: creatininase-product complex
Class: hydrolase
Keywords: Mn-activated creatininase, substrate complex, hydrolase
Deposited on 2003-12-26, released 2004-01-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.183
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creatinine amidohydrolase
    Species: Pseudomonas sp. [TaxId:306]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1v7za_
  • Chain 'B':
    Compound: creatinine amidohydrolase
    Species: Pseudomonas sp. [TaxId:306]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1v7zb_
  • Chain 'C':
    Compound: creatinine amidohydrolase
    Species: Pseudomonas sp. [TaxId:306]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1v7zc_
  • Chain 'D':
    Compound: creatinine amidohydrolase
    Species: Pseudomonas sp. [TaxId:306]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1v7zd_
  • Chain 'E':
    Compound: creatinine amidohydrolase
    Species: Pseudomonas sp. [TaxId:306]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1v7ze_
  • Chain 'F':
    Compound: creatinine amidohydrolase
    Species: Pseudomonas sp. [TaxId:306]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1v7zf_
  • Heterogens: MN, ZN, SO4, CRN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v7zA (A:)
    msksvfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaeri
    galvmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmngh
    yensmfivegidlalrelryagiqdfkvvvlsywdfvkdpaviqqlypegflgwdiehgg
    vfetslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgel
    ilevcvqgiadaireefppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7zA (A:)
    ksvfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaeriga
    lvmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmnghye
    nsmfivegidlalrelryagiqdfkvvvlsywdfvkdpaviqqlypegflgwdiehggvf
    etslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgelil
    evcvqgiadaireefpp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v7zB (B:)
    msksvfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaeri
    galvmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmngh
    yensmfivegidlalrelryagiqdfkvvvlsywdfvkdpaviqqlypegflgwdiehgg
    vfetslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgel
    ilevcvqgiadaireefppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7zB (B:)
    ksvfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaeriga
    lvmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmnghye
    nsmfivegidlalrelryagiqdfkvvvlsywdfvkdpaviqqlypegflgwdiehggvf
    etslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgelil
    evcvqgiadaireefpp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v7zC (C:)
    msksvfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaeri
    galvmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmngh
    yensmfivegidlalrelryagiqdfkvvvlsywdfvkdpaviqqlypegflgwdiehgg
    vfetslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgel
    ilevcvqgiadaireefppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7zC (C:)
    ksvfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaeriga
    lvmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmnghye
    nsmfivegidlalrelryagiqdfkvvvlsywdfvkdpaviqqlypegflgwdiehggvf
    etslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgelil
    evcvqgiadaireefpp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1v7zD (D:)
    msksvfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaeri
    galvmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmngh
    yensmfivegidlalrelryagiqdfkvvvlsywdfvkdpaviqqlypegflgwdiehgg
    vfetslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgel
    ilevcvqgiadaireefppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7zD (D:)
    ksvfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaeriga
    lvmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmnghye
    nsmfivegidlalrelryagiqdfkvvvlsywdfvkdpaviqqlypegflgwdiehggvf
    etslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgelil
    evcvqgiadaireefpp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1v7zE (E:)
    msksvfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaeri
    galvmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmngh
    yensmfivegidlalrelryagiqdfkvvvlsywdfvkdpaviqqlypegflgwdiehgg
    vfetslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgel
    ilevcvqgiadaireefppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7zE (E:)
    ksvfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaeriga
    lvmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmnghye
    nsmfivegidlalrelryagiqdfkvvvlsywdfvkdpaviqqlypegflgwdiehggvf
    etslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgelil
    evcvqgiadaireefpp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1v7zF (F:)
    msksvfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaeri
    galvmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmngh
    yensmfivegidlalrelryagiqdfkvvvlsywdfvkdpaviqqlypegflgwdiehgg
    vfetslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgel
    ilevcvqgiadaireefppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7zF (F:)
    ksvfvgeltwkeyearvaagdcvlmlpvgaleqhghhmcmnvdvllptavckrvaeriga
    lvmpglqygyksqqksgggnhfpgttsldgatltgtvqdiirelarhgarrlvlmnghye
    nsmfivegidlalrelryagiqdfkvvvlsywdfvkdpaviqqlypegflgwdiehggvf
    etslmlalypdlvdldrvvdhppatfppydvfpvdpartpapgtlssaktasrekgelil
    evcvqgiadaireefpp