PDB entry 1v7x

View 1v7x on RCSB PDB site
Description: Crystal structure of Vibrio proteolyticus chitobiose phosphorylase in complex with GlcNAc and sulfate
Class: transferase
Keywords: beta-sandwich, (alpha/alpha)6 barrel, TRANSFERASE
Deposited on 2003-12-24, released 2004-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.163
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitobiose phosphorylase
    Species: Vibrio proteolyticus [TaxId:671]
    Gene: chbp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v7xa1, d1v7xa2
  • Heterogens: NDG, NAG, CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v7xA (A:)
    mkygyfdndnreyvitrpdvpapwtnylgtekfctvishnaggysfynspeynrvtkfrp
    natfdrpghyvylrdddsgdywsiswqpvaksldeaqyqirhglsyskfqcdyngihark
    tlfvpkgedaeiwdvvikntsdqvrtisafsfvefsfshiqsdnqnhqmslysagtayrp
    glieydlyyntddfegfyylastfdpdsydgqrdrflglyrdeanplaveqgrcsnsaqt
    cynhcgslhkqftlqpgeeirfayilgigkgngerlrehyqdvanidaafaaikahwder
    cakfqvkspnqgldtminawtlyqaetcvvwsrfasfievggrtglgyrdtaqdaisvph
    anpemtrkrivdllrgqvkagyglhlfdpdwfdpekedvapsksptvvptpsdedkihgi
    kdtcsddhlwliptickyvmetgetsffdqmipyadggeasvyehmkaaldfsaeyvgqt
    gickglradwndclnlgggessmvsflhfwalqefidlakflgkdqdvntytemaanvre
    acethlwddeggwyirgltkngdkigtaqqqegrvhlesntlavlsglasqergeqamda
    vdehlfspyglhlnapsfstpnddigfvtrvyqgvkengaifshpnpwawvaetklgrgd
    ramkfydalnpynqndiiekriaepysyvqfimgrdhqdhgranhpwltgtsgwayfavt
    nyilgvqsgftglsvdpcipsdwpgfevtrqwrgatyhiqvenpdhvskgvksitlngap
    iqgrippqaqgsdnqvvvvlghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7xA (A:)
    mkygyfdndnreyvitrpdvpapwtnylgtekfctvishnaggysfynspeynrvtkfrp
    natfdrpghyvylrdddsgdywsiswqpvaksldeaqyqirhglsyskfqcdyngihark
    tlfvpkgedaeiwdvvikntsdqvrtisafsfvefsfshiqsdnqnhqmslysagtayrp
    glieydlyyntddfegfyylastfdpdsydgqrdrflglyrdeanplaveqgrcsnsaqt
    cynhcgslhkqftlqpgeeirfayilgigkgngerlrehyqdvanidaafaaikahwder
    cakfqvkspnqgldtminawtlyqaetcvvwsrfasfievggrtglgyrdtaqdaisvph
    anpemtrkrivdllrgqvkagyglhlfdpdwfdpihgikdtcsddhlwliptickyvmet
    getsffdqmipyadggeasvyehmkaaldfsaeyvgqtgickglradwndclnlgggess
    mvsflhfwalqefidlakflgkdqdvntytemaanvreacethlwddeggwyirgltkng
    dkigtaqqqegrvhlesntlavlsglasqergeqamdavdehlfspyglhlnapsfstpn
    ddigfvtrvyqgvkengaifshpnpwawvaetklgrgdramkfydalnpynqndiiekri
    aepysyvqfimgrdhqdhgranhpwltgtsgwayfavtnyilgvqsgftglsvdpcipsd
    wpgfevtrqwrgatyhiqvenpdhvskgvksitlngapiqgrippqaqgsdnqvvvvlg