PDB entry 1v7u

View 1v7u on RCSB PDB site
Description: Crystal structure of Undecaprenyl Pyrophosphate Synthase with farnesyl pyrophosphate
Class: transferase
Keywords: prenyltransferase, farnesyl pyrophosphate, isopentenyl pyrophosphate, substrate binding
Deposited on 2003-12-24, released 2004-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.173
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Undecaprenyl pyrophosphate synthetase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v7ua_
  • Chain 'B':
    Compound: Undecaprenyl pyrophosphate synthetase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v7ub_
  • Heterogens: FPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v7uA (A:)
    mmlsatqplseklpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaann
    giealtlyafssenwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrl
    qerirksealtagntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqh
    vcmhelapvdlvirtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
    rrfggtepgdeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7uA (A:)
    lpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafss
    enwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealta
    gntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlv
    irtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v7uB (B:)
    mmlsatqplseklpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaann
    giealtlyafssenwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrl
    qerirksealtagntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqh
    vcmhelapvdlvirtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
    rrfggtepgdeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7uB (B:)
    gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssepaq
    evsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltln
    iaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehr
    isnfllwqiayaelyftdvlwpdfdeqdfegalnafanre