PDB entry 1v7r

View 1v7r on RCSB PDB site
Description: Structure of nucleotide triphosphate pyrophosphatase from pyrococcus horikoshii OT3
Class: hydrolase
Keywords: NTPase, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE
Deposited on 2003-12-22, released 2003-12-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.202
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein PH1917
  Species: Pyrococcus horikoshii [TaxId:70601]
  Gene: NTPase
  Database cross-references and differences (RAF-indexed):
  • Uniprot O59580 (0-185)
  Domains in SCOPe 2.08: d1v7ra_
• Heterogens: CIT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v7rA (A:)
  mkiffitsnpgkvrevanflgtfgieivqlkheypeiqaekledvvdfgiswlkgkvpep
  fmiedsglfieslkgfpgvyssyvyrtiglegilklmegaedrrayfksvigfyidgkay
  kfsgvtwgrisnekrgthgfgydpifipegsektfaemtieeknalshrgkalkaffewl
  kvnlky