PDB entry 1v7p

View 1v7p on RCSB PDB site
Description: structure of ems16-alpha2-i domain complex
Deposited on 2003-12-19, released 2004-09-07
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-07, with a file datestamp of 2004-09-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.188
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1v7pa_
  • Chain 'B':
    Domains in SCOP 1.69: d1v7pb_
  • Chain 'C':
    Domains in SCOP 1.69: d1v7pc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v7pA (A:)
    dfdcpsdwtaydqhcylaigepqnwyeaerfcteqakdghlvsiqsreegnfvaqlvsgf
    mhrseiyvwiglrdrreeqqcnpewndgskiiyvnwkegeskmcqgltkwtnfhdwnnin
    cedlypfvckfsav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v7pB (B:)
    cplgwssfdqhcykvfepvknwteaeeicmqqhkgsrlasihsseeeafvsklaskalkf
    tsmwiglnnpwkdckwewsdnarfdykawkrrpyctvmvvkpdrifwftrgceksvsfvc
    kfltdpav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7pB (B:)
    cplgwssfdqhcykvfepvknwteaeeicmqqhkgsrlasihsseeeafvsklaskalkf
    tsmwiglnnpwkdckwewsdnarfdykawkrrpyctvmvvkpdrifwftrgceksvsfvc
    kfltdpa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v7pC (C:)
    gsspslidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnl
    ntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdges
    hdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsd
    eaallekagtlgeqifsieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7pC (C:)
    lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt
    keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
    lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
    ekagtlgeqifsi