PDB entry 1v7o

View 1v7o on RCSB PDB site
Description: Alanyl-tRNA synthetase editing domain homologue protein from Pyrococcus horikoshii
Class: hydrolase
Keywords: hydrolase
Deposited on 2003-12-18, released 2004-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: 0.235
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alanyl-tRNA synthetase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH0574
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58307 (0-End)
      • modified residue (0)
      • modified residue (84)
      • modified residue (89)
    Domains in SCOPe 2.07: d1v7oa_
  • Chain 'B':
    Compound: Alanyl-tRNA synthetase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH0574
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58307 (0-End)
      • modified residue (0)
      • modified residue (84)
      • modified residue (89)
    Domains in SCOPe 2.07: d1v7ob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v7oA (A:)
    mysievrthsalhvvkgavvkvlgseakwtystyvkgnkgvlivkfdrkpsdeeireier
    lanekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeh
    tkttgeigpikirkvrfrkskglleihfellelenpslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7oA (A:)
    mysievrthsalhvvkgavvkvlgseakwtystyvkgnkgvlivkfdrkpsdeeireier
    lanekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeh
    tkttgeigpikirkvrfrkskglleihfellelen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v7oB (B:)
    mysievrthsalhvvkgavvkvlgseakwtystyvkgnkgvlivkfdrkpsdeeireier
    lanekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeh
    tkttgeigpikirkvrfrkskglleihfellelenpslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7oB (B:)
    mysievrthsalhvvkgavvkvlgseakwtystyvkgnkgvlivkfdrkpsdeeireier
    lanekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeh
    tkttgeigpikirkvrfrkskglleihfellel