PDB entry 1v7n

View 1v7n on RCSB PDB site
Description: Human Thrombopoietin Functional Domain Complexed To Neutralizing Antibody TN1 Fab
Deposited on 2003-12-18, released 2004-03-02
The last revision prior to the SCOP 1.69 freeze date was dated 2004-03-02, with a file datestamp of 2004-03-02.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.174
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v7nH (H:)
    evkleesggglvqpggsmklscaasgftfsdawmdwvrqspekglewvaeirskvnnhai
    hyaesvkgrftvsrddskssvylqmnslraedtgiyycsgwsflywgqgtlvtvsaaktt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v7nI (I:)
    evkleesggglvqpggsmklscaasgftfsdawmdwvrqspekglewvaeirskvnnhai
    hyaesvkgrftvsrddskssvylqmnslraedtgiyycsgwsflywgqgtlvtvsaaktt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v7nJ (J:)
    evkleesggglvqpggsmklscaasgftfsdawmdwvrqspekglewvaeirskvnnhai
    hyaesvkgrftvsrddskssvylqmnslraedtgiyycsgwsflywgqgtlvtvsaaktt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v7nK (K:)
    evkleesggglvqpggsmklscaasgftfsdawmdwvrqspekglewvaeirskvnnhai
    hyaesvkgrftvsrddskssvylqmnslraedtgiyycsgwsflywgqgtlvtvsaaktt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v7nL (L:)
    qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
    frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1v7nM (M:)
    qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
    frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7nM (M:)
    qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
    frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1v7nN (N:)
    qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
    frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7nN (N:)
    qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
    frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v7nO (O:)
    qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
    frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1v7nV (V:)
    spappacdlrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetka
    qdilgavtlllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlpprgrtta
    hkdpnaiflsfqhllrgkvrflmlvggstlcvrrappttavps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7nV (V:)
    cdlrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetkaqdilga
    vtlllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlpprgrttahkdpna
    iflsfqhllrgkvrflmlvggstlc
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1v7nX (X:)
    spappacdlrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetka
    qdilgavtlllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlpprgrtta
    hkdpnaiflsfqhllrgkvrflmlvggstlcvrrappttavps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7nX (X:)
    dlrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetkaqdilgav
    tlllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlpprgrttahkdpnai
    flsfqhllrgkvrflmlv
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1v7nY (Y:)
    spappacdlrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetka
    qdilgavtlllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlpprgrtta
    hkdpnaiflsfqhllrgkvrflmlvggstlcvrrappttavps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7nY (Y:)
    dlrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetkaqdilgav
    tlllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlpprgrttahkdpnai
    flsfqhllrgkvrflmlvg
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1v7nZ (Z:)
    spappacdlrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetka
    qdilgavtlllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlpprgrtta
    hkdpnaiflsfqhllrgkvrflmlvggstlcvrrappttavps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7nZ (Z:)
    lrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetkaqdilgavt
    lllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlpprgrttahkdpnaif
    lsfqhllrgkvrflmlvg