PDB entry 1v7n

View 1v7n on RCSB PDB site
Description: Human Thrombopoietin Functional Domain Complexed To Neutralizing Antibody TN1 Fab
Class: immune system/cytokine
Keywords: Thrombopoietin, Fab fragment, Complex (Cytokine/Antibody), IMMUNE SYSTEM/CYTOKINE COMPLEX
Deposited on 2003-12-18, released 2004-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.174
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Monoclonal TN1 Fab Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V7N (0-216)
    Domains in SCOPe 2.07: d1v7nh1, d1v7nh2
  • Chain 'I':
    Compound: Monoclonal TN1 Fab Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V7N (0-216)
    Domains in SCOPe 2.07: d1v7ni1, d1v7ni2
  • Chain 'J':
    Compound: Monoclonal TN1 Fab Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V7N (0-216)
    Domains in SCOPe 2.07: d1v7nj1, d1v7nj2
  • Chain 'K':
    Compound: Monoclonal TN1 Fab Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V7N (0-216)
    Domains in SCOPe 2.07: d1v7nk1, d1v7nk2
  • Chain 'L':
    Compound: Monoclonal TN1 Fab Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V7N (0-212)
    Domains in SCOPe 2.07: d1v7nl1, d1v7nl2
  • Chain 'M':
    Compound: Monoclonal TN1 Fab Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V7N (0-End)
    Domains in SCOPe 2.07: d1v7nm1, d1v7nm2
  • Chain 'N':
    Compound: Monoclonal TN1 Fab Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V7N (0-End)
    Domains in SCOPe 2.07: d1v7nn1, d1v7nn2
  • Chain 'O':
    Compound: Monoclonal TN1 Fab Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V7N (0-212)
    Domains in SCOPe 2.07: d1v7no1, d1v7no2
  • Chain 'V':
    Compound: Thrombopoietin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40225
      • engineered (114)
    Domains in SCOPe 2.07: d1v7nv_
  • Chain 'X':
    Compound: Thrombopoietin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40225
      • engineered (114)
    Domains in SCOPe 2.07: d1v7nx_
  • Chain 'Y':
    Compound: Thrombopoietin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40225
      • engineered (114)
    Domains in SCOPe 2.07: d1v7ny_
  • Chain 'Z':
    Compound: Thrombopoietin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40225
      • engineered (114)
    Domains in SCOPe 2.07: d1v7nz_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v7nH (H:)
    evkleesggglvqpggsmklscaasgftfsdawmdwvrqspekglewvaeirskvnnhai
    hyaesvkgrftvsrddskssvylqmnslraedtgiyycsgwsflywgqgtlvtvsaaktt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v7nI (I:)
    evkleesggglvqpggsmklscaasgftfsdawmdwvrqspekglewvaeirskvnnhai
    hyaesvkgrftvsrddskssvylqmnslraedtgiyycsgwsflywgqgtlvtvsaaktt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v7nJ (J:)
    evkleesggglvqpggsmklscaasgftfsdawmdwvrqspekglewvaeirskvnnhai
    hyaesvkgrftvsrddskssvylqmnslraedtgiyycsgwsflywgqgtlvtvsaaktt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v7nK (K:)
    evkleesggglvqpggsmklscaasgftfsdawmdwvrqspekglewvaeirskvnnhai
    hyaesvkgrftvsrddskssvylqmnslraedtgiyycsgwsflywgqgtlvtvsaaktt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v7nL (L:)
    qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
    frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1v7nM (M:)
    qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
    frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7nM (M:)
    qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
    frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1v7nN (N:)
    qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
    frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7nN (N:)
    qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
    frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v7nO (O:)
    qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
    frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1v7nV (V:)
    spappacdlrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetka
    qdilgavtlllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlpprgrtta
    hkdpnaiflsfqhllrgkvrflmlvggstlcvrrappttavps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7nV (V:)
    cdlrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetkaqdilga
    vtlllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlpprgrttahkdpna
    iflsfqhllrgkvrflmlvggstlc
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1v7nX (X:)
    spappacdlrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetka
    qdilgavtlllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlpprgrtta
    hkdpnaiflsfqhllrgkvrflmlvggstlcvrrappttavps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7nX (X:)
    dlrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetkaqdilgav
    tlllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlpprgrttahkdpnai
    flsfqhllrgkvrflmlv
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1v7nY (Y:)
    spappacdlrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetka
    qdilgavtlllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlpprgrtta
    hkdpnaiflsfqhllrgkvrflmlvggstlcvrrappttavps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7nY (Y:)
    dlrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetkaqdilgav
    tlllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlpprgrttahkdpnai
    flsfqhllrgkvrflmlvg
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1v7nZ (Z:)
    spappacdlrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetka
    qdilgavtlllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlpprgrtta
    hkdpnaiflsfqhllrgkvrflmlvggstlcvrrappttavps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7nZ (Z:)
    lrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetkaqdilgavt
    lllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlpprgrttahkdpnaif
    lsfqhllrgkvrflmlvg