PDB entry 1v7m

View 1v7m on RCSB PDB site
Description: Human Thrombopoietin Functional Domain Complexed To Neutralizing Antibody TN1 Fab
Deposited on 2003-12-18, released 2004-03-02
The last revision prior to the SCOP 1.69 freeze date was dated 2004-03-02, with a file datestamp of 2004-03-02.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.232
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v7mH (H:)
    evkleesggglvqpggsmklscaasgftfsdawmdwvrqspekglewvaeirskvnnhai
    hyaesvkgrftvsrddskssvylqmnslraedtgiyycsgwsflywgqgtlvtvsaaktt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v7mI (I:)
    evkleesggglvqpggsmklscaasgftfsdawmdwvrqspekglewvaeirskvnnhai
    hyaesvkgrftvsrddskssvylqmnslraedtgiyycsgwsflywgqgtlvtvsaaktt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1v7mL (L:)
    qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
    frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7mL (L:)
    qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
    frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1v7mM (M:)
    qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
    frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7mM (M:)
    qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
    frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1v7mV (V:)
    spappacdlrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetka
    qdilgavtlllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlppqgrtta
    hkdpnaiflsfqhllrgkvrflmlvggstlcvrrappttavps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7mV (V:)
    cdlrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetkaqdilga
    vtlllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlppqgrttahkdpna
    iflsfqhllrgkvrflmlvggstlc
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1v7mX (X:)
    spappacdlrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetka
    qdilgavtlllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlppqgrtta
    hkdpnaiflsfqhllrgkvrflmlvggstlcvrrappttavps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7mX (X:)
    cdlrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetkaqdilga
    vtlllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlppqgrttahkdpna
    iflsfqhllrgkvrflmlvggstlc