PDB entry 1v7c

View 1v7c on RCSB PDB site
Description: Crystal structure of threonine synthase from thermus thermophilus hb8 in complex with a substrate analogue
Deposited on 2003-12-16, released 2003-12-30
The last revision prior to the SCOP 1.69 freeze date was dated 2003-12-30, with a file datestamp of 2003-12-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1v7ca_
  • Chain 'B':
    Domains in SCOP 1.69: d1v7cb_
  • Chain 'C':
    Domains in SCOP 1.69: d1v7cc_
  • Chain 'D':
    Domains in SCOP 1.69: d1v7cd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v7cA (A:)
    mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf
    kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs
    lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph
    yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata
    irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl
    lregrlepestvvltltghglkdpataervaelpppvparleavaaaagll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v7cB (B:)
    mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf
    kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs
    lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph
    yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata
    irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl
    lregrlepestvvltltghglkdpataervaelpppvparleavaaaagll
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v7cC (C:)
    mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf
    kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs
    lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph
    yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata
    irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl
    lregrlepestvvltltghglkdpataervaelpppvparleavaaaagll
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v7cD (D:)
    mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf
    kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs
    lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph
    yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata
    irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl
    lregrlepestvvltltghglkdpataervaelpppvparleavaaaagll