PDB entry 1v7b

View 1v7b on RCSB PDB site
Description: TetR-family transcription factor CGL2612 from C.glutamicum
Class: gene reguration
Keywords: HTH motif, GENE REGURATION
Deposited on 2003-12-16, released 2005-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-07-08, with a file datestamp of 2008-07-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.208
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator
    Species: Corynebacterium glutamicum ATCC 13032 [TaxId:196627]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v7ba3, d1v7ba4
  • Chain 'B':
    Compound: Transcriptional regulator
    Species: Corynebacterium glutamicum ATCC 13032 [TaxId:196627]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v7bb3, d1v7bb4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v7bA (A:)
    mrtskkemilrtaidyigeysletlsydslaeatglsksgliyhfpsrhalllgmhella
    ddwdkelrditrdpedplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqw
    ipdtddlendahkravylvqlaadglfvhdyihddvlskskrqamletilelipsqtleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7bA (A:)
    mrtskkemilrtaidyigeysletlsydslaeatglsksgliyhfpsrhalllgmhella
    ddwdkelrditrdpedplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqw
    ipdtddlendahkravylvqlaadglfvhdyihddvlskskrqamletilelips
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v7bB (B:)
    mrtskkemilrtaidyigeysletlsydslaeatglsksgliyhfpsrhalllgmhella
    ddwdkelrditrdpedplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqw
    ipdtddlendahkravylvqlaadglfvhdyihddvlskskrqamletilelipsqtleh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7bB (B:)
    tskkemilrtaidyigeysletlsydslaeatglsksgliyhfpsrhalllgmhelladd
    wdkelrditrdpedplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqwip
    dtddlendahkravylvqlaadglfvhdyihddvlskskrqamletilelip